Lineage for d1wm9c1 (1wm9 C:32-216)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868802Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 868803Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 868804Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 868805Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 868949Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries)
    Uniprot Q5SH52 32-216
  8. 868962Domain d1wm9c1: 1wm9 C:32-216 [121039]
    automatically matched to 1WM9 A:32-216
    complexed with zn

Details for d1wm9c1

PDB Entry: 1wm9 (more details), 2.2 Å

PDB Description: Structure of GTP cyclohydrolase I from Thermus thermophilus HB8
PDB Compounds: (C:) GTP cyclohydrolase I

SCOP Domain Sequences for d1wm9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm9c1 d.96.1.1 (C:32-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]}
evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
lshlr

SCOP Domain Coordinates for d1wm9c1:

Click to download the PDB-style file with coordinates for d1wm9c1.
(The format of our PDB-style files is described here.)

Timeline for d1wm9c1: