Lineage for d1wm9a1 (1wm9 A:32-216)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries)
    Uniprot Q5SH52 32-216
  8. Domain d1wm9a1: 1wm9 A:32-216 [121037]
    complexed with zn

Details for d1wm9a1

PDB Entry: 1wm9 (more details), 2.2 Å

PDB Description: Structure of GTP cyclohydrolase I from Thermus thermophilus HB8
PDB Compounds: (A:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1wm9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm9a1 d.96.1.1 (A:32-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]}
evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
lshlr

SCOPe Domain Coordinates for d1wm9a1 are not available.

Timeline for d1wm9a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wm9b_, d1wm9c_, d1wm9d_, d1wm9e_