Lineage for d1wm6h_ (1wm6 H:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. Protein automated matches [190102] (7 species)
    not a true protein
  7. Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)
  8. Domain d1wm6h_: 1wm6 H: [121036]
    automated match to d1j1ya_
    complexed with cl

Details for d1wm6h_

PDB Entry: 1wm6 (more details), 2.4 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (H:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wm6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm6h_ d.38.1.5 (H:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1wm6h_ are not available.

Timeline for d1wm6h_:

Domains from other chains:
(mouse over for more information)
d1wm6a_, d1wm6b_, d1wm6c_, d1wm6d_, d1wm6e_, d1wm6f_, d1wm6g_