Lineage for d1wm6d_ (1wm6 D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201078Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1201079Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1201307Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1201400Protein automated matches [190102] (5 species)
    not a true protein
  7. 1201446Species Thermus thermophilus [TaxId:300852] [186824] (5 PDB entries)
  8. 1201469Domain d1wm6d_: 1wm6 D: [121032]
    automated match to d1j1ya_
    complexed with cl

Details for d1wm6d_

PDB Entry: 1wm6 (more details), 2.4 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (D:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wm6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm6d_ d.38.1.5 (D:) automated matches {Thermus thermophilus [TaxId: 300852]}
mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1wm6d_:

Click to download the PDB-style file with coordinates for d1wm6d_.
(The format of our PDB-style files is described here.)

Timeline for d1wm6d_: