Lineage for d1wm6c1 (1wm6 C:2-117)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721646Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)
  7. 721652Species Thermus thermophilus [TaxId:274] [102909] (5 PDB entries)
  8. 721666Domain d1wm6c1: 1wm6 C:2-117 [121031]
    automatically matched to d1j1ya_
    complexed with cl

Details for d1wm6c1

PDB Entry: 1wm6 (more details), 2.4 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (C:) Phenylacetic acid degradation protein paaI

SCOP Domain Sequences for d1wm6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm6c1 d.38.1.5 (C:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}
rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOP Domain Coordinates for d1wm6c1:

Click to download the PDB-style file with coordinates for d1wm6c1.
(The format of our PDB-style files is described here.)

Timeline for d1wm6c1: