SCOPe 2.07: Domain d1wm6b_: 1wm6 B:

Lineage for d1wm6b_ (1wm6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein automated matches [190102] (7 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)

8. Domain d1wm6b_: 1wm6 B: [121030]
   automated match to d1j1ya_
   complexed with cl

Details for d1wm6b_

PDB Entry: 1wm6, 2.4 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8

PDB Compounds: (B:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wm6b_:

Sequence; same for both SEQRES and ATOM records:

>d1wm6b_ d.38.1.5 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

Timeline for d1wm6b_:

• d1wm6b_ first appeared in SCOP 1.73, called d1wm6b1
  
• d1wm6b_ appears in SCOPe 2.06
  
• d1wm6b_ appears in the current release, SCOPe 2.08