Lineage for d1wm6a_ (1wm6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550920Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2551031Protein automated matches [190102] (7 species)
    not a true protein
  7. 2551089Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)
  8. 2551109Domain d1wm6a_: 1wm6 A: [121029]
    automated match to d1j1ya_
    complexed with cl

Details for d1wm6a_

PDB Entry: 1wm6 (more details), 2.4 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (A:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm6a_ d.38.1.5 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1wm6a_:

Click to download the PDB-style file with coordinates for d1wm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1wm6a_: