Lineage for d1wm5a_ (1wm5 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922477Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 922478Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 922567Protein automated matches [190103] (1 species)
    not a true protein
  7. 922568Species Human (Homo sapiens) [TaxId:9606] [186825] (6 PDB entries)
  8. 922569Domain d1wm5a_: 1wm5 A: [121028]
    automated match to d1hh8a_
    complexed with so4

Details for d1wm5a_

PDB Entry: 1wm5 (more details), 1.95 Å

PDB Description: Crystal structure of the N-terminal TPR domain (1-203) of p67phox
PDB Compounds: (A:) neutrophil cytosol factor 2

SCOPe Domain Sequences for d1wm5a_:

Sequence, based on SEQRES records: (download)

>d1wm5a_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsmslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmtea
ekaftrsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqf
klfacevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvv
ipvgklfrpnerqvaqlakkdylgkat

Sequence, based on observed residues (ATOM records): (download)

>d1wm5a_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsmslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmtea
ekaftrsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqf
klfacevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvv
ipvgklfrpnerqvaqlkdylgkat

SCOPe Domain Coordinates for d1wm5a_:

Click to download the PDB-style file with coordinates for d1wm5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wm5a_: