Lineage for d1wm5a2 (1wm5 A:1-203)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726794Protein automated matches [190103] (5 species)
    not a true protein
  7. 2726805Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries)
  8. 2726806Domain d1wm5a2: 1wm5 A:1-203 [121028]
    Other proteins in same PDB: d1wm5a3
    automated match to d1hh8a_
    complexed with so4

Details for d1wm5a2

PDB Entry: 1wm5 (more details), 1.95 Å

PDB Description: Crystal structure of the N-terminal TPR domain (1-203) of p67phox
PDB Compounds: (A:) neutrophil cytosol factor 2

SCOPe Domain Sequences for d1wm5a2:

Sequence, based on SEQRES records: (download)

>d1wm5a2 a.118.8.1 (A:1-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaf
trsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfa
cevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvg
klfrpnerqvaqlakkdylgkat

Sequence, based on observed residues (ATOM records): (download)

>d1wm5a2 a.118.8.1 (A:1-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaf
trsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfa
cevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvg
klfrpnerqvaqlkdylgkat

SCOPe Domain Coordinates for d1wm5a2:

Click to download the PDB-style file with coordinates for d1wm5a2.
(The format of our PDB-style files is described here.)

Timeline for d1wm5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wm5a3