SCOPe 2.01: Domain d1wlzc_: 1wlz C:

Lineage for d1wlzc_ (1wlz C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein automated matches [190808] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188079] (1 PDB entry)

8. Domain d1wlzc_: 1wlz C: [121026]
   Other proteins in same PDB: d1wlza1
   automated match to d1wlza1

Details for d1wlzc_

PDB Entry: 1wlz, 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis

PDB Compounds: (C:) CAP-binding protein complex interacting protein 1 isoform a

SCOPe Domain Sequences for d1wlzc_:

Sequence; same for both SEQRES and ATOM records:

>d1wlzc_ a.39.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
lwnempvnakgrlkypdflsrfs

Timeline for d1wlzc_:

• d1wlzc_ first appeared in SCOP 1.73, called d1wlzc1
  
• d1wlzc_ was called d1wlzc1 in SCOP 1.75
  
• d1wlzc_ appears in SCOPe 2.02
  
• d1wlzc_ appears in the current release, SCOPe 2.08