SCOP 1.75: Domain d1wlvg1: 1wlv G:3-117

Lineage for d1wlvg1 (1wlv G:3-117)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins)

6. Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102909] (5 PDB entries)

8. Domain d1wlvg1: 1wlv G:3-117 [121022]
   automatically matched to d1j1ya_
   complexed with act, cl, coa

Details for d1wlvg1

PDB Entry: 1wlv, 1.9 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8

PDB Compounds: (G:) Phenylacetic acid degradation protein paaI

SCOP Domain Sequences for d1wlvg1:

Sequence; same for both SEQRES and ATOM records:

>d1wlvg1 d.38.1.5 (G:3-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}
dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

Timeline for d1wlvg1:

• d1wlvg1 first appeared in SCOP 1.73
  
• d1wlvg1 is called d1wlvg_ in SCOPe 2.01
  
• d1wlvg1 appears in the current release, SCOPe 2.08, called d1wlvg_