| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) ![]() |
| Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins) |
| Protein Phenylacetic acid degradation protein PaaI [89903] (2 species) |
| Species Thermus thermophilus [TaxId:274] [102909] (5 PDB entries) |
| Domain d1wlve1: 1wlv E:3-117 [121020] automatically matched to d1j1ya_ complexed with act, cl, coa |
PDB Entry: 1wlv (more details), 1.9 Å
SCOP Domain Sequences for d1wlve1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlve1 d.38.1.5 (E:3-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}
dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
Timeline for d1wlve1: