Lineage for d1wlua_ (1wlu A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188023Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2188134Protein automated matches [190102] (7 species)
    not a true protein
  7. 2188192Species Thermus thermophilus HB8 [TaxId:300852] [186824] (5 PDB entries)
  8. 2188193Domain d1wlua_: 1wlu A: [121015]
    automated match to d1j1ya_
    complexed with cl, gol

Details for d1wlua_

PDB Entry: 1wlu (more details), 1.45 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (A:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wlua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlua_ d.38.1.5 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgp
avalscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1wlua_:

Click to download the PDB-style file with coordinates for d1wlua_.
(The format of our PDB-style files is described here.)

Timeline for d1wlua_: