Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species) synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase |
Species Sulfolobus tokodaii [TaxId:111955] [141586] (2 PDB entries) Uniprot Q96Z62 1-176 |
Domain d1wlta1: 1wlt A:1-176 [121013] |
PDB Entry: 1wlt (more details), 1.9 Å
SCOPe Domain Sequences for d1wlta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Sulfolobus tokodaii [TaxId: 111955]} mpfefenlgmgiilikpkvfpdkrgfflevfksedftkmripnviqtnmsfsrkgvvrgl hyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvkaelneenhymlwippgfahgf qaledsiviyfithneyspphercisysyidwpikeviisdkdlqcpslekaevfd
Timeline for d1wlta1: