SCOPe 2.02: Domain d1wlpb1: 1wlp B:229-281

Lineage for d1wlpb1 (1wlp B:229-281)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)

8. Domain d1wlpb1: 1wlp B:229-281 [121010]
   automatically matched to d1ov3a1

Details for d1wlpb1

PDB Entry: 1wlp

PDB Description: solution structure of the p22phox-p47phox complex

PDB Compounds: (B:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1wlpb1:

Sequence; same for both SEQRES and ATOM records:

>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
epyvaikaytavegdevsllegeavevihklldgwwvirkddvtgyfpsmylq

Timeline for d1wlpb1:

• d1wlpb1 first appeared in SCOP 1.73
  
• d1wlpb1 appears in SCOPe 2.01
  
• d1wlpb1 appears in SCOPe 2.03
  
• d1wlpb1 appears in the current release, SCOPe 2.08