Lineage for d1wlna1 (1wln A:8-114)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779760Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1779761Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1779795Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 1779796Protein Afadin [141135] (1 species)
  7. 1779797Species Mouse (Mus musculus) [TaxId:10090] [141136] (1 PDB entry)
    Uniprot Q9QZQ1 382-487
  8. 1779798Domain d1wlna1: 1wln A:8-114 [121009]

Details for d1wlna1

PDB Entry: 1wln (more details)

PDB Description: solution structure of the fha domain of mouse afadin 6
PDB Compounds: (A:) Afadin

SCOPe Domain Sequences for d1wlna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]}
peklpylvelspdgsdsrdkpklyrlqlsvtevgtekfddnsiqlfgpgiqphhcdltnm
dgvvtvtprsmdaetyvdgqrisettmlqsgmrlqfgtshvfkfvdp

SCOPe Domain Coordinates for d1wlna1:

Click to download the PDB-style file with coordinates for d1wlna1.
(The format of our PDB-style files is described here.)

Timeline for d1wlna1: