Lineage for d1wlma1 (1wlm A:8-145)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 641389Family a.39.1.11: p25-alpha [140538] (2 proteins)
    Pfam PF05517; comprises two degenerate EF-hands and extra C-terminal helix, packed agains the bundle end
  6. 641393Protein Protein cgi-38 [140541] (1 species)
  7. 641394Species Mouse (Mus musculus) [TaxId:10090] [140542] (1 PDB entry)
  8. 641395Domain d1wlma1: 1wlm A:8-145 [121008]

Details for d1wlma1

PDB Entry: 1wlm (more details)

PDB Description: solution structure of mouse cgi-38 protein
PDB Compounds: (A:) Protein CGI-38

SCOP Domain Sequences for d1wlma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]}
maastdiagleesfrkfaihgdpkasgqemngknwaklckdckvadgkavtgtdvdivfs
kvkaksarvinyeefkkaleelatkrfkgkskeeafdaicqliagkepanigvtkaktgg
avdrltdtskytgshker

SCOP Domain Coordinates for d1wlma1:

Click to download the PDB-style file with coordinates for d1wlma1.
(The format of our PDB-style files is described here.)

Timeline for d1wlma1: