SCOPe 2.05: Domain d1wlkc_: 1wlk C:

Lineage for d1wlkc_ (1wlk C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein FMN-binding protein [50477] (1 species)

7. Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (10 PDB entries)

8. Domain d1wlkc_: 1wlk C: [121004]
   automated match to d1axj__
   complexed with fmn; mutant

Details for d1wlkc_

PDB Entry: 1wlk, 1.9 Å

PDB Description: l122e mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f)

PDB Compounds: (C:) fmn-binding protein

SCOPe Domain Sequences for d1wlkc_:

Sequence; same for both SEQRES and ATOM records:

>d1wlkc_ b.45.1.1 (C:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
te

Timeline for d1wlkc_:

• d1wlkc_ first appeared in SCOP 1.73, called d1wlkc1
  
• d1wlkc_ appears in SCOPe 2.04
  
• d1wlkc_ appears in SCOPe 2.06
  
• d1wlkc_ appears in the current release, SCOPe 2.08