Lineage for d1wlka1 (1wlk A:1-121)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 669992Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 670002Protein FMN-binding protein [50477] (1 species)
  7. 670003Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (5 PDB entries)
  8. 670010Domain d1wlka1: 1wlk A:1-121 [121002]
    automatically matched to d1axj__
    complexed with fmn; mutant

Details for d1wlka1

PDB Entry: 1wlk (more details), 1.9 Å

PDB Description: l122e mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f)
PDB Compounds: (A:) fmn-binding protein

SCOP Domain Sequences for d1wlka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlka1 b.45.1.1 (A:1-121) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
t

SCOP Domain Coordinates for d1wlka1:

Click to download the PDB-style file with coordinates for d1wlka1.
(The format of our PDB-style files is described here.)

Timeline for d1wlka1: