| Class b: All beta proteins [48724] (165 folds) |
| Fold b.45: Split barrel-like [50474] (2 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
| Family b.45.1.1: PNP-oxidase like [50476] (16 proteins) |
| Protein FMN-binding protein [50477] (1 species) |
| Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (5 PDB entries) |
| Domain d1wlka1: 1wlk A:1-121 [121002] automatically matched to d1axj__ complexed with fmn; mutant |
PDB Entry: 1wlk (more details), 1.9 Å
SCOP Domain Sequences for d1wlka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlka1 b.45.1.1 (A:1-121) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
t
Timeline for d1wlka1: