![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55929] (19 PDB entries) |
![]() | Domain d1wl9a2: 1wl9 A:177-440 [120999] Other proteins in same PDB: d1wl9a1 automated match to d1n51a2 complexed with cl, mn |
PDB Entry: 1wl9 (more details), 1.9 Å
SCOPe Domain Sequences for d1wl9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wl9a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d1wl9a2: