Lineage for d1wl7a1 (1wl7 A:2-313)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416839Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2416849Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2416850Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2416861Protein Arabinanase-TS [141534] (1 species)
  7. 2416862Species Bacillus thermodenitrificans [TaxId:33940] [141535] (1 PDB entry)
    Uniprot Q93HT9 1-312
  8. 2416863Domain d1wl7a1: 1wl7 A:2-313 [120996]
    complexed with ca

Details for d1wl7a1

PDB Entry: 1wl7 (more details), 1.9 Å

PDB Description: Structure of the thermostable arabinanase
PDB Compounds: (A:) arabinanase-TS

SCOPe Domain Sequences for d1wl7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wl7a1 b.67.2.1 (A:2-313) Arabinanase-TS {Bacillus thermodenitrificans [TaxId: 33940]}
vhfhpfgnvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenmg
rvfpslpdwckqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnrtldp
rdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmkp
aaqaelltiasrgeepnaieapfivcrngyyylfvsfdfccrgiestykiavgrskditg
pyvdkngvsmmqgggtildagndrwigpghcavyfsgvsailvnhaydalkngeptlqir
plywddegwpyl

SCOPe Domain Coordinates for d1wl7a1:

Click to download the PDB-style file with coordinates for d1wl7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wl7a1: