Lineage for d1wl6a2 (1wl6 A:177-440)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta foldsSuperfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) 
Protein Aminopeptidase P, C-terminal domain [55928] (2 species) Species Escherichia coli [TaxId:562] [55929] (20 PDB entries) 
Domain d1wl6a2: 1wl6 A:177-440 [120995]
Other proteins in same PDB: d1wl6a1
automated match to d1n51a2
complexed with cl, ipa, mg, xpe
Details for d1wl6a2
PDB Entry: 1wl6 (more details), 2 Å
PDB Description: Mg-substituted form of E. coli aminopeptidase P
PDB Compounds: (A:) xaa-pro aminopeptidaseSCOPe Domain Sequences for d1wl6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wl6a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq
SCOPe Domain Coordinates for d1wl6a2:
Click to download the PDB-style file with coordinates for d1wl6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wl6a2:
- d1wl6a2 first appeared in SCOP 1.73
- d1wl6a2 appears in SCOPe 2.07
View in 3D
