Lineage for d1wkya1 (1wky A:340-490)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774914Family b.18.1.31: beta-mannanase CBM [141119] (1 protein)
  6. 2774915Protein Endo-beta-1,4-mannanase C-terminal domain [141120] (1 species)
  7. 2774916Species Bacillus sp. JAMB-602 [TaxId:244966] [141121] (1 PDB entry)
    Uniprot Q4W8M3 340-490
  8. 2774917Domain d1wkya1: 1wky A:340-490 [120992]
    Other proteins in same PDB: d1wkya2
    complexed with ca, cl, na

Details for d1wkya1

PDB Entry: 1wky (more details), 1.65 Å

PDB Description: Crystal structure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module
PDB Compounds: (A:) endo-beta-1,4-Mannanase

SCOPe Domain Sequences for d1wkya1:

Sequence, based on SEQRES records: (download)

>d1wkya1 b.18.1.31 (A:340-490) Endo-beta-1,4-mannanase C-terminal domain {Bacillus sp. JAMB-602 [TaxId: 244966]}
pttlydfeestqgwtgsslsrgpwtvtewsskgnhslkadiqmssnsqhylhviqnrslq
qnsriqatvkhanwgsvgngmtarlyvktghgytwysgsfvpingssgttlsldlsnvqn
lsqvreigvqfqsesnssgqtsiyidnvive

Sequence, based on observed residues (ATOM records): (download)

>d1wkya1 b.18.1.31 (A:340-490) Endo-beta-1,4-mannanase C-terminal domain {Bacillus sp. JAMB-602 [TaxId: 244966]}
pttlydfeestqgwtgsslsrgpwtvtewsskgnhslkadiqmssnsqhylhviqnrslq
qnsriqatvkhagmtarlyvktghgytwysgsfvpingssgttlsldlsnvqnlsqvrei
gvqfqsesnssgqtsiyidnvive

SCOPe Domain Coordinates for d1wkya1:

Click to download the PDB-style file with coordinates for d1wkya1.
(The format of our PDB-style files is described here.)

Timeline for d1wkya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wkya2