Lineage for d1wkwa_ (1wkw A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204134Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2204135Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2204136Family d.86.1.1: Translation initiation factor eIF4e [55419] (2 proteins)
    automatically mapped to Pfam PF01652
  6. 2204137Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2204141Species Human (Homo sapiens) [TaxId:9606] [160542] (15 PDB entries)
  8. 2204160Domain d1wkwa_: 1wkw A: [120991]
    automated match to d1ipba_
    protein/RNA complex; complexed with gta

Details for d1wkwa_

PDB Entry: 1wkw (more details), 2.1 Å

PDB Description: crystal structure of the ternary complex of eif4e-m7gpppa-4ebp1 peptide
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d1wkwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkwa_ d.86.1.1 (A:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
evanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlm
pgcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddys
ddvcgavvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatk
sgsttknrfvv

SCOPe Domain Coordinates for d1wkwa_:

Click to download the PDB-style file with coordinates for d1wkwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wkwa_: