Lineage for d1wkwa1 (1wkw A:27-217)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728664Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 728665Superfamily d.86.1: eIF4e-like [55418] (2 families) (S)
  5. 728666Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
  6. 728667Protein Translation initiation factor eIF4e [55420] (2 species)
    messenger RNA 5' cap-binding protein
  7. 728671Species Mouse (Mus musculus) [TaxId:10090] [55421] (7 PDB entries)
  8. 728676Domain d1wkwa1: 1wkw A:27-217 [120991]
    automatically matched to d1ipba_
    complexed with gta

Details for d1wkwa1

PDB Entry: 1wkw (more details), 2.1 Å

PDB Description: crystal structure of the ternary complex of eif4e-m7gpppa-4ebp1 peptide
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOP Domain Sequences for d1wkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkwa1 d.86.1.1 (A:27-217) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
evanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlm
pgcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddys
ddvcgavvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatk
sgsttknrfvv

SCOP Domain Coordinates for d1wkwa1:

Click to download the PDB-style file with coordinates for d1wkwa1.
(The format of our PDB-style files is described here.)

Timeline for d1wkwa1: