Lineage for d1wkvb1 (1wkv B:2-383)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709069Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 709070Species Archaeon Aeropyrum pernix [TaxId:56636] [142742] (1 PDB entry)
  8. 709072Domain d1wkvb1: 1wkv B:2-383 [120990]
    automatically matched to 1WKV A:2-383
    complexed with act, plp

Details for d1wkvb1

PDB Entry: 1wkv (more details), 2 Å

PDB Description: Crystal structure of O-phosphoserine sulfhydrylase
PDB Compounds: (B:) Cysteine synthase

SCOP Domain Sequences for d1wkvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkvb1 c.79.1.1 (B:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnale

SCOP Domain Coordinates for d1wkvb1:

Click to download the PDB-style file with coordinates for d1wkvb1.
(The format of our PDB-style files is described here.)

Timeline for d1wkvb1: