Lineage for d1wkvb_ (1wkv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139874Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2139875Species Aeropyrum pernix [TaxId:56636] [142742] (3 PDB entries)
    Uniprot Q9YBL2 1-382
  8. 2139877Domain d1wkvb_: 1wkv B: [120990]
    automated match to d1wkva1
    complexed with act, plp

Details for d1wkvb_

PDB Entry: 1wkv (more details), 2 Å

PDB Description: Crystal structure of O-phosphoserine sulfhydrylase
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d1wkvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkvb_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cysteine synthase) {Aeropyrum pernix [TaxId: 56636]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnaleg

SCOPe Domain Coordinates for d1wkvb_:

Click to download the PDB-style file with coordinates for d1wkvb_.
(The format of our PDB-style files is described here.)

Timeline for d1wkvb_: