Lineage for d1wkva1 (1wkv A:2-383)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2514801Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2514910Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2514911Species Aeropyrum pernix [TaxId:56636] [142742] (7 PDB entries)
    Uniprot Q9YBL2 1-382
  8. 2514916Domain d1wkva1: 1wkv A:2-383 [120989]
    complexed with act, plp

Details for d1wkva1

PDB Entry: 1wkv (more details), 2 Å

PDB Description: Crystal structure of O-phosphoserine sulfhydrylase
PDB Compounds: (A:) Cysteine synthase

SCOPe Domain Sequences for d1wkva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Aeropyrum pernix [TaxId: 56636]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvkdrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqfyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgirrvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnale

SCOPe Domain Coordinates for d1wkva1:

Click to download the PDB-style file with coordinates for d1wkva1.
(The format of our PDB-style files is described here.)

Timeline for d1wkva1: