![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries) Uniprot Q5SLV5 1-137 |
![]() | Domain d1wklb_: 1wkl B: [120988] automated match to d1wkja1 complexed with adp, atp, mg, phs |
PDB Entry: 1wkl (more details), 2.2 Å
SCOPe Domain Sequences for d1wklb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wklb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl edaqreialffrpeell
Timeline for d1wklb_: