Lineage for d1wklb_ (1wkl B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194606Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
    Uniprot Q5SLV5 1-137
  8. 2194612Domain d1wklb_: 1wkl B: [120988]
    automated match to d1wkja1
    complexed with adp, atp, mg, phs

Details for d1wklb_

PDB Entry: 1wkl (more details), 2.2 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8 in Complex with ATP and ADP
PDB Compounds: (B:) nucleotide diphosphate kinase

SCOPe Domain Sequences for d1wklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wklb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

SCOPe Domain Coordinates for d1wklb_:

Click to download the PDB-style file with coordinates for d1wklb_.
(The format of our PDB-style files is described here.)

Timeline for d1wklb_: