SCOPe 2.04: Domain d1wklb_: 1wkl B:

Lineage for d1wklb_ (1wkl B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
   Uniprot Q5SLV5 1-137

8. Domain d1wklb_: 1wkl B: [120988]
   automated match to d1wkja1
   complexed with adp, atp, mg, phs

Details for d1wklb_

PDB Entry: 1wkl, 2.2 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8 in Complex with ATP and ADP

PDB Compounds: (B:) nucleotide diphosphate kinase

SCOPe Domain Sequences for d1wklb_:

Sequence; same for both SEQRES and ATOM records:

>d1wklb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

Timeline for d1wklb_:

• d1wklb_ first appeared in SCOP 1.73, called d1wklb1
  
• d1wklb_ appears in SCOPe 2.03
  
• d1wklb_ appears in SCOPe 2.05
  
• d1wklb_ appears in the current release, SCOPe 2.08