SCOP 1.73: Domain d1wkkb1: 1wkk B:1-137

Lineage for d1wkkb1 (1wkk B:1-137)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)

8. Domain d1wkkb1: 1wkk B:1-137 [120986]
   automatically matched to 1WKJ A:1-137
   complexed with gdp

Details for d1wkkb1

PDB Entry: 1wkk, 2.7 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8 in Complex with GDP

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1wkkb1:

Sequence; same for both SEQRES and ATOM records:

>d1wkkb1 d.58.6.1 (B:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

Timeline for d1wkkb1:

• d1wkkb1 is new in SCOP 1.73
  
• d1wkkb1 appears in SCOP 1.75
  
• d1wkkb1 appears in the current release, SCOPe 2.08, called d1wkkb_