SCOPe 2.08: Domain d1wkkb_: 1wkk B:

Lineage for d1wkkb_ (1wkk B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
   Uniprot Q5SLV5 1-137

8. Domain d1wkkb_: 1wkk B: [120986]
   automated match to d1wkja1
   complexed with gdp

Details for d1wkkb_

PDB Entry: 1wkk, 2.7 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8 in Complex with GDP

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1wkkb_:

Sequence; same for both SEQRES and ATOM records:

>d1wkkb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

Timeline for d1wkkb_:

• d1wkkb_ first appeared in SCOP 1.73, called d1wkkb1
  
• d1wkkb_ appears in SCOPe 2.07