![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries) |
![]() | Domain d1wkka1: 1wkk A:1-137 [120985] automatically matched to 1WKJ A:1-137 complexed with gdp |
PDB Entry: 1wkk (more details), 2.7 Å
SCOP Domain Sequences for d1wkka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkka1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl edaqreialffrpeell
Timeline for d1wkka1: