Lineage for d1wkga1 (1wkg A:9-395)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705854Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 705923Protein Acetylornithine/acetyl-lysine aminotransferase ArgD [142674] (1 species)
  7. 705924Species Thermus thermophilus [TaxId:274] [142675] (3 PDB entries)
  8. 705929Domain d1wkga1: 1wkg A:9-395 [120979]
    automatically matched to 1VEF A:9-395
    complexed with poi

Details for d1wkga1

PDB Entry: 1wkg (more details), 2.25 Å

PDB Description: acetylornithine aminotransferase from thermus thermophilus hb8
PDB Compounds: (A:) Acetylornithine/acetyl-lysine aminotransferase

SCOP Domain Sequences for d1wkga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkga1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]}
wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
virflpplviekedlervveavravla

SCOP Domain Coordinates for d1wkga1:

Click to download the PDB-style file with coordinates for d1wkga1.
(The format of our PDB-style files is described here.)

Timeline for d1wkga1: