Lineage for d1wkaa1 (1wka A:195-337)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1131794Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1131795Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1131796Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
    inserted into the catalytic domain
  6. 1131815Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species)
  7. 1131816Species Thermus thermophilus [TaxId:274] [50683] (5 PDB entries)
  8. 1131817Domain d1wkaa1: 1wka A:195-337 [120978]
    automatically matched to d1gaxa2

Details for d1wkaa1

PDB Entry: 1wka (more details), 1.7 Å

PDB Description: Structural basis for non-cognate amino acid discrimination by the valyl-tRNA synthetase editing domain
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1wkaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkaa1 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi
ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr
fearrkavelfreaghlvkeedy

SCOPe Domain Coordinates for d1wkaa1:

Click to download the PDB-style file with coordinates for d1wkaa1.
(The format of our PDB-style files is described here.)

Timeline for d1wkaa1: