Class b: All beta proteins [48724] (180 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins) inserted into the catalytic domain |
Protein automated matches [226874] (1 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [225032] (4 PDB entries) |
Domain d1wkaa_: 1wka A: [120978] automated match to d1wkaa1 |
PDB Entry: 1wka (more details), 1.7 Å
SCOPe Domain Sequences for d1wkaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkaa_ b.51.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]} gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr fearrkavelfreaghlvkeedy
Timeline for d1wkaa_: