Lineage for d1wkaa_ (1wka A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802538Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 2802539Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 2802540Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 2802569Protein automated matches [226874] (1 species)
    not a true protein
  7. 2802570Species Thermus thermophilus [TaxId:274] [225032] (4 PDB entries)
  8. 2802573Domain d1wkaa_: 1wka A: [120978]
    automated match to d1wkaa1

Details for d1wkaa_

PDB Entry: 1wka (more details), 1.7 Å

PDB Description: Structural basis for non-cognate amino acid discrimination by the valyl-tRNA synthetase editing domain
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1wkaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkaa_ b.51.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi
ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr
fearrkavelfreaghlvkeedy

SCOPe Domain Coordinates for d1wkaa_:

Click to download the PDB-style file with coordinates for d1wkaa_.
(The format of our PDB-style files is described here.)

Timeline for d1wkaa_: