SCOPe 2.04: Domain d1wk9a_: 1wk9 A:

Lineage for d1wk9a_ (1wk9 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
   inserted into the catalytic domain

6. Protein automated matches [226874] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [225032] (4 PDB entries)

8. Domain d1wk9a_: 1wk9 A: [120977]
   automated match to d1wkaa1
   complexed with tsb

Details for d1wk9a_

PDB Entry: 1wk9, 1.75 Å

PDB Description: Structural basis for non-cognate amino acid discrimination by the valyl-tRNA synthetase editing domain

PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1wk9a_:

Sequence; same for both SEQRES and ATOM records:

>d1wk9a_ b.51.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi
ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr
fearrkavelfreaghlvkeedy

Timeline for d1wk9a_:

• d1wk9a_ first appeared in SCOP 1.73, called d1wk9a1
  
• d1wk9a_ was called d1wk9a1 in SCOPe 2.03
  
• d1wk9a_ appears in SCOPe 2.05
  
• d1wk9a_ appears in the current release, SCOPe 2.08