SCOPe 2.03: Domain d1wk9a1: 1wk9 A:195-337

Lineage for d1wk9a1 (1wk9 A:195-337)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
   inserted into the catalytic domain

6. Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50683] (5 PDB entries)

8. Domain d1wk9a1: 1wk9 A:195-337 [120977]
   automatically matched to d1gaxa2
   complexed with tsb

Details for d1wk9a1

PDB Entry: 1wk9, 1.75 Å

PDB Description: Structural basis for non-cognate amino acid discrimination by the valyl-tRNA synthetase editing domain

PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1wk9a1:

Sequence; same for both SEQRES and ATOM records:

>d1wk9a1 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi
ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr
fearrkavelfreaghlvkeedy

Timeline for d1wk9a1:

• d1wk9a1 first appeared in SCOP 1.73
  
• d1wk9a1 appears in SCOPe 2.02
  
• d1wk9a1 is called d1wk9a_ in SCOPe 2.04
  
• d1wk9a1 appears in the current release, SCOPe 2.08, called d1wk9a_