Class b: All beta proteins [48724] (165 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins) inserted into the catalytic domain |
Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species) |
Species Thermus thermophilus [TaxId:274] [50683] (5 PDB entries) |
Domain d1wk9a1: 1wk9 A:195-337 [120977] automatically matched to d1gaxa2 complexed with tsb |
PDB Entry: 1wk9 (more details), 1.75 Å
SCOP Domain Sequences for d1wk9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wk9a1 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr fearrkavelfreaghlvkeedy
Timeline for d1wk9a1: