Lineage for d1wj7a1 (1wj7 A:8-98)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696117Protein Ubiquitin-associated protein 2-like Ubap2l [140331] (1 species)
    RSGI ruh-015
  7. 2696118Species Mouse (Mus musculus) [TaxId:10090] [140332] (1 PDB entry)
    Uniprot Q80X50 19-109
  8. 2696119Domain d1wj7a1: 1wj7 A:8-98 [120976]
    Other proteins in same PDB: d1wj7a2, d1wj7a3
    has additional insertions and/or extensions that are not grouped together

Details for d1wj7a1

PDB Entry: 1wj7 (more details)

PDB Description: solution structure of rsgi ruh-015, a uba domain from mouse cdna
PDB Compounds: (A:) Hypothetical protein (RSGI RUH-015)

SCOPe Domain Sequences for d1wj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]}
nqnqtqhkqrpqataeqirlaqmisdhndadfeekvkqliditgknqdecvialhdcngd
vnrainvllegnpdthswemvgkkkgvsgqk

SCOPe Domain Coordinates for d1wj7a1:

Click to download the PDB-style file with coordinates for d1wj7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wj7a1: