Class a: All alpha proteins [46456] (290 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.1: UBA domain [46935] (25 proteins) |
Protein Ubiquitin-associated protein 2-like Ubap2l [140331] (1 species) RSGI ruh-015 |
Species Mouse (Mus musculus) [TaxId:10090] [140332] (1 PDB entry) Uniprot Q80X50 19-109 |
Domain d1wj7a1: 1wj7 A:8-98 [120976] Other proteins in same PDB: d1wj7a2, d1wj7a3 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wj7 (more details)
SCOPe Domain Sequences for d1wj7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} nqnqtqhkqrpqataeqirlaqmisdhndadfeekvkqliditgknqdecvialhdcngd vnrainvllegnpdthswemvgkkkgvsgqk
Timeline for d1wj7a1: