Lineage for d1wisa1 (1wis A:8-118)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372123Protein Sidekick 2 [141051] (1 species)
  7. 2372124Species Human (Homo sapiens) [TaxId:9606] [141052] (4 PDB entries)
    Uniprot Q58EX2 1279-1395! Uniprot Q58EX2 578-685! Uniprot Q58EX2 881-988! Uniprot Q58EX2 981-1081
  8. 2372125Domain d1wisa1: 1wis A:8-118 [120975]
    Other proteins in same PDB: d1wisa2, d1wisa3
    5th FnIII domain

Details for d1wisa1

PDB Entry: 1wis (more details)

PDB Description: solution structure of the fifth fniii domain from human kiaa1514 protein
PDB Compounds: (A:) KIAA1514 protein

SCOPe Domain Sequences for d1wisa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}
tissgvppelpgpptnlgisnigprsvtlqfrpgydgktsisrwlveaqvgvvgegeewl
lihqlsnepdarsmevpdlnpftcysfrmrqvnivgtsppsqpsrkiqtlq

SCOPe Domain Coordinates for d1wisa1:

Click to download the PDB-style file with coordinates for d1wisa1.
(The format of our PDB-style files is described here.)

Timeline for d1wisa1: