Lineage for d1wi4a1 (1wi4 A:8-103)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312126Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1312127Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1312128Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1312362Protein Syntaxin binding protein 4 [141271] (1 species)
  7. 1312363Species Mouse (Mus musculus) [TaxId:10090] [141272] (1 PDB entry)
    Uniprot Q9WV89 12-107
  8. 1312364Domain d1wi4a1: 1wi4 A:8-103 [120973]

Details for d1wi4a1

PDB Entry: 1wi4 (more details)

PDB Description: solution structure of the pdz domain of syntaxin binding protein 4
PDB Compounds: (A:) syntaxin binding protein 4

SCOPe Domain Sequences for d1wi4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]}
spldrdpafrvitvtketglglkilgginrnegplvyihevipggdcykdgrlkpgdqlv
sinkesmigvsfeeaksiitraklrsespweiafir

SCOPe Domain Coordinates for d1wi4a1:

Click to download the PDB-style file with coordinates for d1wi4a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi4a1: