SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1wi4a1 (1wi4 A:8-103)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048531Protein Syntaxin binding protein 4 [141271] (1 species)
  7. 2048532Species Mouse (Mus musculus) [TaxId:10090] [141272] (1 PDB entry)
    Uniprot Q9WV89 12-107
  8. 2048533Domain d1wi4a1: 1wi4 A:8-103 [120973]
    Other proteins in same PDB: d1wi4a2, d1wi4a3

Details for d1wi4a1

PDB Entry: 1wi4 (more details)

PDB Description: Solution structure of the PDZ domain of syntaxin binding protein 4
PDB Compounds: (A:) syntaxin binding protein 4

SCOPe Domain Sequences for d1wi4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]}
spldrdpafrvitvtketglglkilgginrnegplvyihevipggdcykdgrlkpgdqlv
sinkesmigvsfeeaksiitraklrsespweiafir

SCOPe Domain Coordinates for d1wi4a1:

Click to download the PDB-style file with coordinates for d1wi4a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi4a1: