Lineage for d1wgea1 (1wge A:8-77)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037409Superfamily g.41.17: CSL zinc finger [144217] (2 families) (S)
  5. 3037410Family g.41.17.1: CSL zinc finger [144218] (3 proteins)
    Pfam PF05207
  6. 3037411Protein DelGEF-interacting protein 1, DelGIP1 [144219] (1 species)
  7. 3037412Species Mouse (Mus musculus) [TaxId:10090] [144220] (1 PDB entry)
    Uniprot Q8K0W9 1-69
  8. 3037413Domain d1wgea1: 1wge A:8-77 [120972]
    Other proteins in same PDB: d1wgea2, d1wgea3
    complexed with zn

Details for d1wgea1

PDB Entry: 1wge (more details)

PDB Description: solution structure of the mouse desr1
PDB Compounds: (A:) Hypothetical protein 2610018L09Rik

SCOPe Domain Sequences for d1wgea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]}
mavfhdeveiedfqydedsetyfypcpcgdnfaitkedlengedvatcpscsliikviyd
kdqfmcgetv

SCOPe Domain Coordinates for d1wgea1:

Click to download the PDB-style file with coordinates for d1wgea1.
(The format of our PDB-style files is described here.)

Timeline for d1wgea1: