Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.17: CSL zinc finger [144217] (2 families) |
Family g.41.17.1: CSL zinc finger [144218] (3 proteins) Pfam PF05207 |
Protein DelGEF-interacting protein 1, DelGIP1 [144219] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [144220] (1 PDB entry) Uniprot Q8K0W9 1-69 |
Domain d1wgea1: 1wge A:8-77 [120972] Other proteins in same PDB: d1wgea2, d1wgea3 complexed with zn |
PDB Entry: 1wge (more details)
SCOPe Domain Sequences for d1wgea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} mavfhdeveiedfqydedsetyfypcpcgdnfaitkedlengedvatcpscsliikviyd kdqfmcgetv
Timeline for d1wgea1: