Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Sidekick 2 [141051] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141052] (4 PDB entries) Uniprot Q58EX2 1279-1395! Uniprot Q58EX2 578-685! Uniprot Q58EX2 881-988! Uniprot Q58EX2 981-1081 |
Domain d1wfoa1: 1wfo A:8-124 [120970] Other proteins in same PDB: d1wfoa2, d1wfoa3 8th FnIII domain |
PDB Entry: 1wfo (more details)
SCOPe Domain Sequences for d1wfoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} rigdgspshppilertlddvpgppmgilfpevrttsvrliwqppaapngiilayqithrl ntttantatvevlapsarqytatglkpesvylfritaqtrkgwgeaaealvvttekr
Timeline for d1wfoa1: