Lineage for d1wfoa1 (1wfo A:8-124)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 936133Protein Sidekick 2 [141051] (1 species)
  7. 936134Species Human (Homo sapiens) [TaxId:9606] [141052] (4 PDB entries)
    Uniprot Q58EX2 1279-1395! Uniprot Q58EX2 578-685! Uniprot Q58EX2 881-988! Uniprot Q58EX2 981-1081
  8. 936137Domain d1wfoa1: 1wfo A:8-124 [120970]
    8th FnIII domain

Details for d1wfoa1

PDB Entry: 1wfo (more details)

PDB Description: The eighth FN3 domain of human sidekick-2
PDB Compounds: (A:) sidekick 2

SCOPe Domain Sequences for d1wfoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}
rigdgspshppilertlddvpgppmgilfpevrttsvrliwqppaapngiilayqithrl
ntttantatvevlapsarqytatglkpesvylfritaqtrkgwgeaaealvvttekr

SCOPe Domain Coordinates for d1wfoa1:

Click to download the PDB-style file with coordinates for d1wfoa1.
(The format of our PDB-style files is described here.)

Timeline for d1wfoa1: