Lineage for d1wf9a1 (1wf9 A:8-101)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402272Protein NPL4-like protein 1 [142934] (1 species)
  7. 1402273Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142935] (1 PDB entry)
    Uniprot Q9LYC2 2-95
  8. 1402274Domain d1wf9a1: 1wf9 A:8-101 [120968]

Details for d1wf9a1

PDB Entry: 1wf9 (more details)

PDB Description: Solution structure of a novel beta-grasp fold like domain of Hypothetical protein (Arabidopsis thaliana)
PDB Compounds: (A:) NPL4 family protein

SCOPe Domain Sequences for d1wf9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tmlrvrsrdglervsvdgphitvsqlktliqdqlqipihnqtlstnrnlllakspsdfla
ftdmadpnlrisslnlahgsmvylayegertirg

SCOPe Domain Coordinates for d1wf9a1:

Click to download the PDB-style file with coordinates for d1wf9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wf9a1: