Lineage for d1wf9a1 (1wf9 A:8-101)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931460Protein NPL4-like protein 1 [142934] (1 species)
  7. 2931461Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142935] (1 PDB entry)
    Uniprot Q9LYC2 2-95
  8. 2931462Domain d1wf9a1: 1wf9 A:8-101 [120968]
    Other proteins in same PDB: d1wf9a2, d1wf9a3

Details for d1wf9a1

PDB Entry: 1wf9 (more details)

PDB Description: solution structure of a novel beta-grasp fold like domain of hypothetical protein (arabidopsis thaliana)
PDB Compounds: (A:) NPL4 family protein

SCOPe Domain Sequences for d1wf9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tmlrvrsrdglervsvdgphitvsqlktliqdqlqipihnqtlstnrnlllakspsdfla
ftdmadpnlrisslnlahgsmvylayegertirg

SCOPe Domain Coordinates for d1wf9a1:

Click to download the PDB-style file with coordinates for d1wf9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wf9a1: