Lineage for d1wf8a1 (1wf8 A:8-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786009Protein Neurabin-i [141277] (1 species)
  7. 2786010Species Human (Homo sapiens) [TaxId:9606] [141278] (1 PDB entry)
    Uniprot Q9ULJ8 500-593
  8. 2786011Domain d1wf8a1: 1wf8 A:8-101 [120967]
    Other proteins in same PDB: d1wf8a2, d1wf8a3

Details for d1wf8a1

PDB Entry: 1wf8 (more details)

PDB Description: solution structure of the pdz domain of spinophilin/neurabinii protein
PDB Compounds: (A:) Neurabin-I

SCOPe Domain Sequences for d1wf8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]}
lelfpvelekdedglgisiigmgvgadagleklgifvktvteggaaqrdgriqvndqive
vdgislvgvtqnfaatvlrntkgnvrfvigrekp

SCOPe Domain Coordinates for d1wf8a1:

Click to download the PDB-style file with coordinates for d1wf8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wf8a1: