Lineage for d1wf5a1 (1wf5 A:8-115)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657557Protein Sidekick 2 [141051] (1 species)
  7. 657558Species Human (Homo sapiens) [TaxId:9606] [141052] (4 PDB entries)
  8. 657559Domain d1wf5a1: 1wf5 A:8-115 [120966]
    1st FnIII domain

Details for d1wf5a1

PDB Entry: 1wf5 (more details)

PDB Description: Solution structure of the first Fn3 domain of Sidekick-2 protein
PDB Compounds: (A:) sidekick 2 protein

SCOP Domain Sequences for d1wf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}
rsahlrvrqlphapehpvatlstverrainltwtkpfdgnspliryilemsennapwtvl
lasvdpkatsvtvkglvparsyqfrlcavndvgkgqfskdtervslpe

SCOP Domain Coordinates for d1wf5a1:

Click to download the PDB-style file with coordinates for d1wf5a1.
(The format of our PDB-style files is described here.)

Timeline for d1wf5a1: